SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011601 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011601
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 4.97e-60
Family Dystroglycan, domain 2 0.000000302
Further Details:      
 
Domain Number 2 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 2.2e-19
Family Dystroglycan, N-terminal domain 0.00000289
Further Details:      
 
Domain Number 3 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 1.29e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011601   Gene: ENSGGOG00000011890   Transcript: ENSGGOT00000011937
Sequence length 895
Comment pep:known_by_projection chromosome:gorGor3.1:3:50754426:50822623:1 gene:ENSGGOG00000011890 transcript:ENSGGOT00000011937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGLSLLLPLWGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGL
PLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPSTPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVPITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNTLEPDFKATSIAVTGSGSCRHLQFIP
VVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSGGOP00000011601 ENSGGOP00000011601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]