SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011866 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011866
Domain Number 1 Region: 116-185
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000123
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011866   Gene: ENSGGOG00000012168   Transcript: ENSGGOT00000012207
Sequence length 193
Comment pep:known_by_projection chromosome:gorGor3.1:2a:18159102:18159683:1 gene:ENSGGOG00000012168 transcript:ENSGGOT00000012207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLESYSSSP
CPAVAGLPCEHGGASSGGSDGCSVGGTSGLVEVDYNMLAFQPTYLQGGGGPKAQKGTKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTD
LLNRGREPRAQSA
Download sequence
Identical sequences ENSGGOP00000011866 ENSGGOP00000011866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]