SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011960 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011960
Domain Number 1 Region: 122-194
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-16
Family Complement control module/SCR domain 0.00037
Further Details:      
 
Domain Number 2 Region: 183-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 3 Region: 244-306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000038
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 438-500
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000553
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 494-553
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000542
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 6 Region: 57-126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000891
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 311-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000128
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 8 Region: 397-442
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000216
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011960   Gene: ENSGGOG00000012258   Transcript: ENSGGOT00000012304
Sequence length 609
Comment pep:known_by_projection chromosome:gorGor3.1:1:187097829:187138539:1 gene:ENSGGOG00000012258 transcript:ENSGGOT00000012304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTSAKQQAMHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGDCGP
PPTLSFAAPMDIDIRLTETLFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIH
KRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQC
EIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPN
PPTCEKITCHKPDVSHGEMVSGFGPIYNYKDTILFKCQKGFLLRGSSVIHCDADSKWNPS
PPACEPRVDSCTNLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDAPTTVIC
QKNFRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAI
CQGDGTWSPRTPTCGDICNFPPKIAHGHYKQSSSYSFFKEEITYECDKGYILVGQVKLSC
SYSRWSAPAPQCKALCLKPELLNGRLSVDKDQYVESENVTIQCDSGYGVVGPQSITCSEN
RTWYPEVPKCEWETPEGCEQVLIGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSA
RQSTLDKEL
Download sequence
Identical sequences ENSGGOP00000011960 ENSGGOP00000011960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]