SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000011974 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000011974
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-53
Family DBL homology domain (DH-domain) 0.00000000584
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-47
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 380-505
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-16
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 4 Region: 658-703
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000289
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 5 Region: 588-644
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000609
Family SH2 domain 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000011974
Domain Number - Region: 556-585
Classification Level Classification E-value
Superfamily SH3-domain 0.00334
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000011974   Gene: ENSGGOG00000012257   Transcript: ENSGGOT00000012318
Sequence length 705
Comment pep:known_by_projection chromosome:gorGor3.1:19:6967252:7052045:1 gene:ENSGGOG00000012257 transcript:ENSGGOT00000012318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKSNIYPENATANGHD
FQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKK
DKLHRRAQDKKRNELGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLYNVEVKHIKIMTA
EGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISKPAVGSTKY
FGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGR
Download sequence
Identical sequences ENSGGOP00000011974 ENSGGOP00000011974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]