SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012075 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012075
Domain Number 1 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 200-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 2-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-17
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 160-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012075   Gene: ENSGGOG00000012378   Transcript: ENSGGOT00000012422
Sequence length 549
Comment pep:known_by_projection chromosome:gorGor3.1:19:32030165:32040677:-1 gene:ENSGGOG00000012378 transcript:ENSGGOT00000012422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGEKAKPKITEPTASQLAF
SEESSFQELLAQRSSRDSRLGQARDEEKLIKIQEGNLRPGTNPHKEICPEKLSYKHDDLE
PDDSLGLRVLQERVTPQDALHECDSQGPGKDPMTDARNNPYTCTECGKGFSKKWALVRHQ
QIHAGVKPYECNECGKACRYMADVIRHMRLHTGEKPYKCIECGKAFKRRFHLTEHQRIHT
GDKPYECKECGKAFTHRSSFIQHNMTHTREKPFLCKECGKAFYYSSSFAQHMRIHTGKKL
YECSECGKAFTHRSTFIQHNVTHTGEKPFLCKECGKTFCLNSSFTQHMRIHTGEKPYECG
ECGKAFTHRSTFIRHKRTHTGEKPFECKECGKAFCDSSSLIQHMRIHTGEKPYECSECGK
AFTHHSVFIRHNRTHSGQKPLECKECAKAFYYSSSFTRHMRIHTGEKPYVCRECGKAFTQ
PANFVRHNRIHTGEKPFECKECEKAFCDNFALTQHMRTHTERNPLNAMNVERPSATVHHS
LTIERFIPE
Download sequence
Identical sequences ENSGGOP00000012075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]