SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012081 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012081
Domain Number 1 Region: 137-337
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.87e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 22-111
Classification Level Classification E-value
Superfamily WWE domain 2.75e-17
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012081   Gene: ENSGGOG00000012383   Transcript: ENSGGOT00000012428
Sequence length 338
Comment pep:known_by_projection chromosome:gorGor3.1:12:3917392:3978493:-1 gene:ENSGGOG00000012383 transcript:ENSGGOT00000012428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEANPEMFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSS
EDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICEN
EAIPMPPHWENVNTQVPYQLIPLHSQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEF
FCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRVNGIHGAVFGKGTYFARD
AAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSK
DGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
Download sequence
Identical sequences A0A2I2YPT4
XP_004052570.1.27298 ENSGGOP00000012081 ENSGGOP00000012081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]