SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012123 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012123
Domain Number 1 Region: 957-1224
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.1e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000701
Further Details:      
 
Domain Number 2 Region: 182-437
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.45e-62
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000338
Further Details:      
 
Domain Number 3 Region: 439-642
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 4.5e-53
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1227-1356
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.29e-29
Family Anticodon-binding domain of Class II aaRS 0.00015
Further Details:      
 
Domain Number 5 Region: 1360-1447
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 1.77e-17
Family C-terminal domain of ProRS 0.0057
Further Details:      
 
Domain Number 6 Region: 687-740
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 1.06e-16
Family a tRNA synthase domain 0.0000505
Further Details:      
 
Domain Number 7 Region: 51-161
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.97e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Domain Number 8 Region: 759-813
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000157
Family a tRNA synthase domain 0.00012
Further Details:      
 
Domain Number 9 Region: 839-890
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000000432
Family a tRNA synthase domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012123   Gene: ENSGGOG00000012404   Transcript: ENSGGOT00000012470
Sequence length 1447
Comment pep:known_by_projection chromosome:gorGor3.1:1:200281184:200359360:-1 gene:ENSGGOG00000012404 transcript:ENSGGOT00000012470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLCLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLAR
VATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSAINELNHCLSLRTYLVGNSLSLA
DLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEVQQAFQSVGTKWDVSTTKARVAPEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCKIQPHP
RTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSR
LNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVV
NMEWDKIWAFNKKVIDPVAPRYVALLKKEVIPVNVPEAQEEMKEVAKHPKNPEVGLKPVW
YSPKVFIEGADAETFLEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKDYKKTT
KITWLAETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPCLKDLK
KGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTKVEATK
NETSAPFKERPTPSLNNNCTTSEDSLVLYNRVAVQGDVVRELKAKKAPKEDVDAAVKQLL
SLKAEYKEKTGQEYKPGNPPAEIGQNISSNSSASILESKPLYDEVAAQGEVVRKLKAEKA
PKAKINEAVECLLSLKAQYKEKTGKEYISGQPPLSQSSDSSPTRNSEPAGLETPEAKVLF
DKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKK
KEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKKEENLA
DWYSQVITKSEMIEYHDVSGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQS
ALEKEKTHIADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLN
QWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPV
VKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKTPGEK
QFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDKEALIA
KCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRD
TGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQI
PFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKNPAKYY
TLFGRSY
Download sequence
Identical sequences ENSGGOP00000012123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]