SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012124 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012124
Domain Number 1 Region: 864-1023
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-32
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 1186-1372
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-26
Family Pleckstrin-homology domain (PH domain) 0.0000059
Further Details:      
 
Domain Number 3 Region: 1012-1132
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012124   Gene: ENSGGOG00000012410   Transcript: ENSGGOT00000012471
Sequence length 1376
Comment pep:known_by_projection chromosome:gorGor3.1:12:94178965:94316609:-1 gene:ENSGGOG00000012410 transcript:ENSGGOT00000012471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAAEIKKPPVAPKPKFVVANNKPAPPPIAPKPDIVISSVPQSTKKMKPAIAPKPKVLK
TSPVRDIGQSPSRKIMLNLEGHKQELAESTDNFNCKYEGSQSSDYISPMCSCSSECIHKL
GHRENLCVKQLVLEPLEMNENLENSKIDETLTIKTRSKCDFYGEKAKNQGGVVLKASVLE
EELKDALIHQMPPFISAQKHRPTDSPEVNGGCNSNGQFRIEFADLSPSPSSFEKVPDHHS
CHLQLPSDECEHFETCQDDSEKSNNCFQSSELEALENGKRSTLISSDGVSKKSEVKDLGP
LEIHLVPYTPKFPTPKPRKTRTARLLRQKCVDTPSESTEEPGNSDSSSSCLTENSLKINK
INVLHQNVLCKQEQVDKMKLGNKSELNMESNSDAQDLVNSQKAMCDETTSVEKMAPSFDT
DSNLSSDSTTVDGSSMSLAVDEGTGFIRCTVSMSLPKQLKLTCNEHLQSGRNLGVSAPQM
QKESVIKEENSLRIVPKKPQRHSLPATGVLKKAASEELLEKSSYPSSEEKNSEKSLERNH
LQHLCAQNRGVSSSFDMPKRASEKPVWKLPHPILPFSGNPEFLKSVTVSSNSEPSTALTK
PRAKSLSAMDVEKCTKPCKDSTKKNSFKKLLSMKLSICFMKSDFQKFWSKSSQLGDTTTG
HLSSGEQKGIESDWQGLLVGEKRSKPIKAYSTENYSLESQKKRKKSRGQTSAANGLRAES
LDDQMLSRESSSQAPYKSVTSLCAPEYENIRHYEEIPEYENLPFIMAIRKTQELEWQNSS
SMEDADASVYEVEEPYEAPDGQLQLGPRHQRSSSGASQEEQNDLGLGDLPSDEEEVINSS
DEDDVSSESSKGEPDPLEDKQDEDNGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAV
AHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLHMSPRCANLALKHYLLK
PVQRIPQYRLLLTDYLKNLIEDAGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQ
YSLNGHHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLS
LAGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCP
SRSLDEADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQA
CSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPRIVSPGNHKSPSSALSSVLHSIPSG
RKQKKIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHFWFVIKNKVLYTYAASEDVAAL
ESQPLLGFTVTQVKDENSESKVFQLLHKNMLFYVFKAEDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences ENSGGOP00000012124 ENSGGOP00000012124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]