SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012306 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012306
Domain Number 1 Region: 282-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000294
Further Details:      
 
Domain Number 2 Region: 95-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.15e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 8-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012306   Gene: ENSGGOG00000012613   Transcript: ENSGGOT00000012663
Sequence length 366
Comment pep:known_by_projection chromosome:gorGor3.1:12:51483395:51508015:1 gene:ENSGGOG00000012613 transcript:ENSGGOT00000012663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTI
PYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
PDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQTTSHELTIPNDLI
GCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSET
GGMGSS
Download sequence
Identical sequences A0A0A7HRR6 A0A1S3GI79 A0A250XZF7 A0A2I3GFQ2 A0A2I3MEY6 A0A2I3RI11 A0A2J8SX33 A0A2K5E788 A0A2K5HAZ6 A0A2K5MJ32 A0A2K5VMU6 A0A2K6BXR2 A0A2K6GKC3 A0A2K6M3Z1 A0A2K6R4E6 A0A2K6SHI3 G3RA49 G3VZ72 M3Y3M8
ENSMPUP00000005929 ENSSHAP00000008477 ENSP00000352438 ENSMPUP00000005929 ENSP00000352438 ENSP00000408949 ENSPTRP00000045105 gi|14141168|ref|NP_005007.2| 9606.ENSP00000352438 ENSGGOP00000022079 ENSPTRP00000045105 ENSGGOP00000012306 NP_005007.2.87134 NP_005007.2.92137 XP_004467513.2.11602 XP_004583228.1.84141 XP_004601587.1.94378 XP_004637950.1.9945 XP_004716921.1.18182 XP_005902180.1.15283 XP_006047549.1.26621 XP_006169136.1.99106 XP_006242479.1.100692 XP_006520645.1.92730 XP_006870017.1.41390 XP_006933806.1.62641 XP_006981895.1.50099 XP_007179521.1.59432 XP_007631656.1.28591 XP_007947698.1.48129 XP_008001637.1.81039 XP_008138979.1.99482 XP_008525581.1.77740 XP_008574037.1.73410 XP_008702872.1.72690 XP_008836916.1.79516 XP_009246072.1.23681 XP_010348197.1.74449 XP_010607645.1.5607 XP_010803178.1.76553 XP_010856236.1.44457 XP_010962684.1.22495 XP_011228236.1.58354 XP_012004684.1.54773 XP_012407275.1.9362 XP_012410289.1.4749 XP_012508582.1.63892 XP_012508589.1.63892 XP_012508597.1.63892 XP_012619254.1.48125 XP_012887939.1.60039 XP_012887940.1.60039 XP_012923926.1.39548 XP_013014619.1.53824 XP_013213914.1.77405 XP_013839353.1.46622 XP_013963909.1.84170 XP_014317283.1.53796 XP_014397544.1.60319 XP_014596393.1.31192 XP_014642027.1.5094 XP_014703039.1.49734 XP_014936748.1.86478 XP_014950115.1.66739 XP_015007352.1.72884 XP_015093663.1.17985 XP_015286174.1.63531 XP_015286175.1.63531 XP_015286176.1.63531 XP_015286177.1.63531 XP_015286178.1.63531 XP_016056842.1.3490 XP_016778807.1.37143 XP_017197393.1.1745 XP_017512038.1.32401 XP_017706468.1.44346 XP_017903151.1.57651 XP_018894056.1.27298 XP_019275091.1.44245 XP_019515255.1.44202 XP_019580004.1.88060 XP_020015877.1.5219 XP_020750747.1.74333 XP_021499203.1.76796 XP_021499204.1.76796 XP_021521687.1.9421 XP_021542380.1.83697 XP_021542381.1.83697 GO.56891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]