SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012382 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012382
Domain Number 1 Region: 161-545
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-159
Family Myotubularin-like phosphatases 0.0000000000295
Further Details:      
 
Domain Number 2 Region: 37-157
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-42
Family GRAM domain 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012382   Gene: ENSGGOG00000012689   Transcript: ENSGGOT00000012739
Sequence length 605
Comment pep:known_by_projection chromosome:gorGor3.1:X:148451070:148535513:1 gene:ENSGGOG00000012689 transcript:ENSGGOT00000012739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRMASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPLLPGETLITDKEVIYICPFNGP
IKGRVYITNYRLYLRSLETDSSLILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRN
LRFALKQEGHSRRDMFEILTRYAFPLAHSLPLFAFLNEEKFNVDGWTVYNPVEEYRRQGL
PNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENRTV
IVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANKATGGGYESD
DAYHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAI
QVADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKF
ASRIGHGDKNHTDADRSPIFLQFIDCVWQMSKQFPTAFEFNEQFLIIILDHLYSCRFGTF
LFNCESARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYY
IRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPH
VQTHF
Download sequence
Identical sequences ENSGGOP00000012382 ENSGGOP00000012382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]