SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012391 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012391
Domain Number 1 Region: 432-645
Classification Level Classification E-value
Superfamily TPR-like 5.88e-33
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 660-801
Classification Level Classification E-value
Superfamily TPR-like 1.84e-21
Family Tetratricopeptide repeat (TPR) 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012391
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0296
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012391   Gene: ENSGGOG00000012696   Transcript: ENSGGOT00000012748
Sequence length 914
Comment pep:known_by_projection chromosome:gorGor3.1:12:87011164:87068857:1 gene:ENSGGOG00000012696 transcript:ENSGGOT00000012748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSS
VIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSIIWTPIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESLLDIRNLATFTFFCFLGTLGVFSIRYSGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLK
TFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSY
INEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELK
ALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKISSSSFIEPIFPTSKISSVEGKK
IPTESVKEIRGESRQTQIVKTSDNKSQSKSNKQLGKNGDEETPHKTTKDIKEIEKKRVAA
LKRLEEIERILNGE
Download sequence
Identical sequences G3RAC3 H2Q6K7
9598.ENSPTRP00000008973 ENSPTRP00000008973 XP_016779441.1.37143 XP_018894948.1.27298 XP_522486.2.37143 ENSPTRP00000008973 ENSGGOP00000012391 ENSGGOP00000012391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]