SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012430 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012430
Domain Number 1 Region: 262-381
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.41e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012430
Domain Number - Region: 401-423
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000349
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012430   Gene: ENSGGOG00000012733   Transcript: ENSGGOT00000012790
Sequence length 675
Comment pep:known_by_projection chromosome:gorGor3.1:11:61594800:61608598:-1 gene:ENSGGOG00000012733 transcript:ENSGGOT00000012790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGANATPLGKLGPPGLPPLPGPKGGFEPGPPPAPGPGSGLLAPGPPPPPPVGSMGALT
AAFPFAALPPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPP
PQPPRKDQQPGPAGGGGDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYI
VQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLI
TEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNA
KIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETP
EDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCK
FQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNP
PPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPM
QHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPP
PMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQRSLPAA
AMARAMRVRTFRAHW
Download sequence
Identical sequences XP_004051516.1.27298 ENSGGOP00000012430 ENSGGOP00000012430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]