SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012511 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012511
Domain Number 1 Region: 412-573
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-25
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 2 Region: 565-597
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.000000217
Family Small-conductance potassium channel 0.0016
Further Details:      
 
Domain Number 3 Region: 30-98
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000471
Family beta-sandwich domain of Sec23/24 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012511   Gene: ENSGGOG00000012827   Transcript: ENSGGOT00000012873
Sequence length 687
Comment pep:known_by_projection chromosome:gorGor3.1:1:133702050:133864281:-1 gene:ENSGGOG00000012827 transcript:ENSGGOT00000012873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQ
PPQLQQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILH
PSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYS
GGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATH
NHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIE
TELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYE
RILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIARV
MLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVC
ERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAV
VARKLELTKAEKHVHNFMMDTQLTKRLRSVKMEQRKLSDQANTLVDLSKMQNVMYDLITE
LNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGT
THTPISDSPIGVSSTSFPTPYTSSSSC
Download sequence
Identical sequences ENSGGOP00000012511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]