SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012531 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012531
Domain Number 1 Region: 970-1264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-79
Family Protein kinases, catalytic subunit 0.0000000000945
Further Details:      
 
Domain Number 2 Region: 326-492
Classification Level Classification E-value
Superfamily L domain-like 9.36e-52
Family L domain 0.0000000548
Further Details:      
 
Domain Number 3 Region: 33-188
Classification Level Classification E-value
Superfamily L domain-like 3.69e-42
Family L domain 0.000000107
Further Details:      
 
Domain Number 4 Region: 488-607
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-31
Family Fibronectin type III 0.0000118
Further Details:      
 
Domain Number 5 Region: 783-925
Classification Level Classification E-value
Superfamily Fibronectin type III 8.4e-22
Family Fibronectin type III 0.0000845
Further Details:      
 
Domain Number 6 Region: 610-690,789-827
Classification Level Classification E-value
Superfamily Fibronectin type III 3.33e-21
Family Fibronectin type III 0.00021
Further Details:      
 
Domain Number 7 Region: 169-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.24e-16
Family Growth factor receptor domain 0.0000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012531   Gene: ENSGGOG00000012828   Transcript: ENSGGOT00000012893
Sequence length 1367
Comment pep:known_by_projection chromosome:gorGor3.1:15:78698835:79021343:1 gene:ENSGGOG00000012828 transcript:ENSGGOT00000012893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQAEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Download sequence
Identical sequences G3RAQ4
ENSGGOP00000012531 XP_004056858.1.27298 ENSGGOP00000012531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]