SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012558 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012558
Domain Number 1 Region: 17-217
Classification Level Classification E-value
Superfamily t-snare proteins 7.85e-21
Family t-snare proteins 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012558   Gene: ENSGGOG00000012874   Transcript: ENSGGOT00000012920
Sequence length 302
Comment pep:known_by_projection chromosome:gorGor3.1:9:82037531:82100817:1 gene:ENSGGOG00000012874 transcript:ENSGGOT00000012920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGR
TVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQF
NDEVTLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLI
ELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKLAALPVAGALIG
GMVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRKKQKMMEKLTSSCPDLPSQTDKK
CS
Download sequence
Identical sequences G3RAT0
ENSGGOP00000012558 XP_004048396.1.27298 ENSGGOP00000012558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]