SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012601 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012601
Domain Number 1 Region: 238-300
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.77e-18
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 297-363
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.18e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 177-241
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.86e-16
Family LIM domain 0.0029
Further Details:      
 
Domain Number 4 Region: 116-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000286
Family LIM domain 0.019
Further Details:      
 
Domain Number 5 Region: 359-387
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000104
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012601   Gene: ENSGGOG00000012919   Transcript: ENSGGOT00000012964
Sequence length 388
Comment pep:known_by_projection chromosome:gorGor3.1:2a:102936655:102974967:-1 gene:ENSGGOG00000012919 transcript:ENSGGOT00000012964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRVFSRAGAAQRSTRPAAEPQPPAARALQPRPGVPGPLRRREYLQPAPRREAEGLSHQ
GSEEGAESGARPRERGAEPELGRLWLRTVSSWRLGWHFDFGVAEKPGVKMTERFDCHHCN
ESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQC
RNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHR
CQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTAC
RKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNC
KKCSLSLVGRGFLTERDDILCPDCGKDI
Download sequence
Identical sequences G3RAW9
ENSGGOP00000012601 ENSGGOP00000012601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]