SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012643 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012643
Domain Number 1 Region: 27-122
Classification Level Classification E-value
Superfamily Snake toxin-like 7.9e-25
Family Extracellular domain of cell surface receptors 0.024
Further Details:      
 
Domain Number 2 Region: 135-224
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000131
Family Extracellular domain of cell surface receptors 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012643   Gene: ENSGGOG00000012961   Transcript: ENSGGOT00000013007
Sequence length 346
Comment pep:known_by_projection chromosome:gorGor3.1:19:40661155:40665352:-1 gene:ENSGGOG00000012961 transcript:ENSGGOT00000013007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPARKAGAQAVIWTAGWLLLLLFRGGAQALECYSCVQKADDGCSPNKMKTVKCAPGVDV
CTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLT
SRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLT
AANVTMSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVR
LPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGA
AGHQDRSNSGQYPAKGGPQQPHNKGCVAPTTGLAALLLAVAAGVLL
Download sequence
Identical sequences ENSGGOP00000012643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]