SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012736 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012736
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-28
Family Dual specificity phosphatase-like 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012736   Gene: ENSGGOG00000013057   Transcript: ENSGGOT00000013103
Sequence length 142
Comment pep:known_by_projection chromosome:gorGor3.1:1:32983117:33003253:-1 gene:ENSGGOG00000013057 transcript:ENSGGOT00000013103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGI
HVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRKRRGAFNSKQLLY
LEKYRPKMRLRFRDTNGHCCVQ
Download sequence
Identical sequences A0A287A651 A0A2I3LQT1 A0A2J8Y7G2 A0A2K5DZQ1 A0A2K5K3I7 A0A2K5LEX1 A0A2K5S4C0 A0A2K5WKQ5 A0A2K5ZLX8 A0A2K6BME1 A0A2K6EX04 A0A2K6N539 A0A2K6P7M5 A0A2K6U8Q9 G1QNQ0 G3RB96 H9EN39 K7CJS7 U3FG37
ENSGGOP00000012736 ENSP00000473490 ENSP00000473490 NP_001182029.1.87134 NP_001182029.1.92137 XP_004372070.1.4749 XP_004603612.1.94378 XP_005271288.1.92137 XP_006502926.1.92730 XP_006895015.1.29581 XP_007468720.1.90284 XP_007948653.1.48129 XP_007977805.1.81039 XP_008155246.1.99482 XP_008951738.1.60992 XP_011829420.1.47321 XP_011935109.1.92194 XP_016813589.1.37143 XP_017383400.1.71028 XP_017712551.1.44346 ENSGGOP00000012736 gi|304361762|ref|NP_001182029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]