SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012884 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012884
Domain Number 1 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.95e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 523-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 372-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 200-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000347
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012884
Domain Number - Region: 341-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00487
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012884   Gene: ENSGGOG00000013207   Transcript: ENSGGOT00000013255
Sequence length 581
Comment pep:known_by_projection chromosome:gorGor3.1:X:47277006:47320092:-1 gene:ENSGGOG00000013207 transcript:ENSGGOT00000013255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGHLVEKPDMIFRL
GPGEESWMADGGTPVQTCAGEDRPEVWQVDEQIDHYKESQDKLLWQAAFIGKETLKDESG
QECKICRKIIYLNTDFVSVKQRLPKYYSWERCSKHHLNFLGQNRSYVRKTDDGCKAYWKV
CLHYNLHKAQPAEKFFDPNQQGKALHQKQALRKSQRSQTGEKLYKCTECGKVFIQKANLV
VHQRTHTGEKPYECCECAKAFSQKSTLIAHQRTHTGEKPYECSECGKTFIQKSTLIKHQR
THTGEKPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTTSSLIYQRIHTSEKPQCS
EHGKASDEKPSPTKHWRTHTKENIYECSKCGKSFRGNSHLSVHQRIHTGEKPYECSICGK
TFSGKSHLSVHHRTHTGEKPYECRRCGKAFGEKSTLIVHQRMHTGEKPYQCNECGKAFSE
KSPLIKHQRIHTGERPYECTDCKKAFSRKSTLIKHQRIHTGEKPYKCSECGKAFSVKSTL
IVHHRTHTGEKPYECRDCGKAFSGKSTLIKHQRSHTGGKNL
Download sequence
Identical sequences G3RBM3
XP_004064096.1.27298 ENSGGOP00000012884 ENSGGOP00000012884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]