SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012982 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012982
Domain Number 1 Region: 1-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.27e-102
Family Protein kinases, catalytic subunit 0.000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012982   Gene: ENSGGOG00000013311   Transcript: ENSGGOT00000013357
Sequence length 297
Comment pep:known_by_projection chromosome:gorGor3.1:10:73037381:73053797:1 gene:ENSGGOG00000013311 transcript:ENSGGOT00000013357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Download sequence
Identical sequences A0A2J8WR14 G3RBW7 H2R7P8 P06493
ENSP00000378699 NP_001307847.1.87134 NP_001307847.1.92137 NP_001777.1.87134 NP_001777.1.92137 XP_003830379.1.60992 XP_004049500.1.27298 XP_004049502.2.27298 XP_005270360.1.92137 XP_018891055.1.27298 ENSPTRP00000050657 ENSGGOP00000012982 ENSP00000325970 ENSPTRP00000050657 gi|4502709|ref|NP_001777.1| ENSP00000378699 HR2896 ENSGGOP00000012982 d4yc3a1 4yc6_A 4yc6_C 4yc6_E 4yc6_G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]