SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012992 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012992
Domain Number 1 Region: 36-331
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.54e-63
Family Ankyrin repeat 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012992   Gene: ENSGGOG00000013319   Transcript: ENSGGOT00000013367
Sequence length 361
Comment pep:known_by_projection chromosome:gorGor3.1:10:6039266:6049158:-1 gene:ENSGGOG00000013319 transcript:ENSGGOT00000013367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAW
GMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVI
QELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAM
HGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGA
QALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADI
NSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAM
T
Download sequence
Identical sequences A0A2I2YYT5 Q6P6B7
ENSGGOP00000012992 9606.ENSP00000369434 gi|58331111|ref|NP_061919.1| gi|58331113|ref|NP_001009941.1| ENSP00000352361 ENSGGOP00000012992 NP_001009941.1.87134 NP_001009941.1.92137 NP_061919.1.87134 NP_061919.1.92137 XP_004049072.1.27298 XP_018890360.1.27298 ENSP00000369434 ENSP00000369436 ENSP00000369434 ENSP00000369436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]