SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013081 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013081
Domain Number 1 Region: 301-462
Classification Level Classification E-value
Superfamily EF-hand 5.11e-22
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 2 Region: 154-288
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000132
Family Calmodulin-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013081   Gene: ENSGGOG00000013408   Transcript: ENSGGOT00000013459
Sequence length 575
Comment pep:known_by_projection chromosome:gorGor3.1:X:89061:182757:-1 gene:ENSGGOG00000013408 transcript:ENSGGOT00000013459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTAGDGEQPGAWPT
APLAAPRSSGLEPPGTPGPGPALPVGAASSPRNAPHARGTRRSAGTKVVQTRKEEPLPPA
TSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGLVAKACSCPLYWKG
PLFYGAGGERTGSVSVHKFVTMWRKILQNCHDDTAKFVHLLMSPSCNYLVQEDFVPFLQD
VVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEE
EADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHAISTKMIDRIFSGAV
TRGRKVQKEGKISYAVFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ
CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCELANVVFDTFFNIEKYLDH
EQKQQISLRRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSA
LRSPLAQRPFFEAPSPLGAVDLYEYTCGDEDLEPL
Download sequence
Identical sequences ENSGGOP00000013081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]