SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013121 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013121
Domain Number 1 Region: 378-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 322-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 45-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 477-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 433-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 163-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000148
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013121
Domain Number - Region: 232-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000211
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013121   Gene: ENSGGOG00000013454   Transcript: ENSGGOT00000013499
Sequence length 555
Comment pep:known_by_projection chromosome:gorGor3.1:19:55294801:55302018:-1 gene:ENSGGOG00000013454 transcript:ENSGGOT00000013499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGSMAELTDSARGCVVFEDVFVYFSR
EEWELLDDAQRLLYHDVMLENFALLASLGIAFSRSRAVMKLERGEEPWVYDQVDMTSATE
REAQRGLRPGCWHGVEDEEVSSEQSIFVAGVSEVRTLVAELESHPCDICGPILKDTLHLA
KYHGGKARQKPYLCGACGKQFWFSTDFDQHQNQPNGGKLFPRKEGRDSVKSCRVHVPEKT
LTCGKGRRDFSATSGLLQHQASHSSMKPHKNTKLVSGFLMGQRYHRCGECGKAFTRKDTL
ARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHR
RVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHT
GERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYE
CSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKKSVANVG
ESLRPMPPTYCMVGN
Download sequence
Identical sequences ENSGGOP00000013121 ENSGGOP00000013121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]