SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013158
Domain Number 1 Region: 221-410
Classification Level Classification E-value
Superfamily Serum albumin-like 7.26e-57
Family Serum albumin-like 0.00000671
Further Details:      
 
Domain Number 2 Region: 414-597
Classification Level Classification E-value
Superfamily Serum albumin-like 6.84e-53
Family Serum albumin-like 0.0000124
Further Details:      
 
Domain Number 3 Region: 33-219
Classification Level Classification E-value
Superfamily Serum albumin-like 2.06e-50
Family Serum albumin-like 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013158   Gene: ENSGGOG00000013488   Transcript: ENSGGOT00000013537
Sequence length 599
Comment pep:known_by_projection chromosome:gorGor3.1:4:82051327:82073603:1 gene:ENSGGOG00000013488 transcript:ENSGGOT00000013537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLKLTGFIFFLFFLPESLTLPTQPRDVENFNSTQKFIEENIEYITIIAFAQYVQEATF
EEMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKYNFSHCCSKVDAQ
RRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLT
VAAHFEEVAKSCCEEQNKVNCFQTRAIPVTQYLKAFSSYQKHVCGALLKFGTKVVHFIYI
AILSQKFPKIEFKELISLVEDVSSNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIK
ECCEKKILERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
RHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQ
NLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFG
ELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQN
EELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN
Download sequence
Identical sequences G3RCD3
XP_004038853.1.27298 ENSGGOP00000013158 ENSGGOP00000013158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]