SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013241 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013241
Domain Number 1 Region: 266-318
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000418
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013241
Domain Number - Region: 362-405
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00257
Family Erythroid transcription factor GATA-1 0.039
Further Details:      
 
Domain Number - Region: 7-138
Classification Level Classification E-value
Superfamily BAH domain 0.00458
Family BAH domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013241   Gene: ENSGGOG00000013570   Transcript: ENSGGOT00000013622
Sequence length 668
Comment pep:known_by_projection chromosome:gorGor3.1:11:59374432:59387697:-1 gene:ENSGGOG00000013570 transcript:ENSGGOT00000013622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLAD
SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQY
LEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLAEGESDNRNQQKMEMKVWD
PDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQR
NGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG
FQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAAR
RPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKT
PINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPAST
NEPIVLED
Download sequence
Identical sequences G1QUR5 G3S769
ENSGGOP00000023926 XP_003274125.1.23891 XP_004051403.1.27298 ENSNLEP00000004685 ENSGGOP00000013241 ENSNLEP00000004685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]