SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013276 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013276
Domain Number 1 Region: 196-317
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.1e-49
Family Anticodon-binding domain of Class II aaRS 0.000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013276   Gene: ENSGGOG00000013608   Transcript: ENSGGOT00000013657
Sequence length 579
Comment pep:known_by_projection chromosome:gorGor3.1:20:43904543:43933492:-1 gene:ENSGGOG00000013608 transcript:ENSGGOT00000013657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL
RDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPM
YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT
PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQAS
GNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSV
QKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY
Download sequence
Identical sequences A0A2I3H576 G3RCP3 Q9HCD5
ENSP00000290231 ENSGGOP00000013276 ENSNLEP00000008375 ENSGGOP00000013276 ENSP00000290231 NP_066018.1.87134 NP_066018.1.92137 XP_003826047.1.60992 XP_004062341.1.27298 gi|15147335|ref|NP_066018.1| 9606.ENSP00000290231 ENSP00000290231 NCO5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]