SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013323 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013323
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 321-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 474-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013323   Gene: ENSGGOG00000013664   Transcript: ENSGGOT00000013705
Sequence length 533
Comment pep:known_by_projection chromosome:gorGor3.1:19:33654260:33677404:-1 gene:ENSGGOG00000013664 transcript:ENSGGOT00000013705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAHGLVTFRDVAIDFSQEEWEFLDPAQRDLYRDVMWENYSNFISLGPSISKPDVITLLDE
ERKEPGMVVREGTRRYCPDLESRYRTNTLSPEKDIYEIYSFQWDIMERIKSYSLQGSIFR
NDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFLTEYQIVHNGEKVYECKECRKT
FIRRSTLSQHLRIHTGEKPYKCKECGQAFRQRAHLIRHHKLHTGEKPYECKECGKAFTVL
QELTQHQRLHTGEKPYECKECGKAFRVHQQLARHQRIHTGEKPYECKDCGKTFRQCTHLT
RHQRLHTAEKLYECKECGKAFVCGPDLRVHQKIHFGEKPYECKECGKAFRICQQLTVHQS
IHTGEKPYECKECGKTFRLRQQLVRHQRIHTREKPYECMECWKTFSSYSQLISHQSIHIG
ERPYECEECGKAFRLLSQLTQHQSIHTGEKPYECKECRKPFRLLSQLTQHQSIHTGEKPY
ECKECGKAFRLYSFLTQHQRIHTGEKPYKCKECKKAFRQHSHLTQHQKIHNGI
Download sequence
Identical sequences ENSGGOP00000013323 ENSGGOP00000013323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]