SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013375 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013375
Domain Number 1 Region: 843-1137
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-81
Family Protein kinases, catalytic subunit 0.0000000000659
Further Details:      
 
Domain Number 2 Region: 1-160
Classification Level Classification E-value
Superfamily L domain-like 6.81e-43
Family L domain 0.000000105
Further Details:      
 
Domain Number 3 Region: 287-413
Classification Level Classification E-value
Superfamily L domain-like 1.22e-38
Family L domain 0.000000607
Further Details:      
 
Domain Number 4 Region: 410-533
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-33
Family Fibronectin type III 0.000000141
Further Details:      
 
Domain Number 5 Region: 649-791
Classification Level Classification E-value
Superfamily Fibronectin type III 3.62e-24
Family Fibronectin type III 0.00000222
Further Details:      
 
Domain Number 6 Region: 537-595,655-679
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-17
Family Fibronectin type III 0.0000247
Further Details:      
 
Domain Number 7 Region: 145-291
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000157
Family Growth factor receptor domain 0.0000000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013375   Gene: ENSGGOG00000013703   Transcript: ENSGGOT00000013761
Sequence length 1229
Comment pep:known_by_projection chromosome:gorGor3.1:19:7306997:7463720:-1 gene:ENSGGOG00000013703 transcript:ENSGGOT00000013761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVY
GLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCY
LATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSH
CQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYH
FQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLAAELEANL
GLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHN
LTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYI
RTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPL
RSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVP
LDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKKTSSGTGAE
DPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLR
HFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQE
PKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGN
GSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYA
SSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIIKGEAETR
VAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKS
YLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTV
KIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLA
EQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDD
LHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKR
SYEEHIPYTHMNGGKKNGRILTLPRSNPS
Download sequence
Identical sequences ENSGGOP00000013375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]