SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013406 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013406
Domain Number 1 Region: 570-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-26
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.16e-26
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 640-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 293-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000289
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013406   Gene: ENSGGOG00000013745   Transcript: ENSGGOT00000013792
Sequence length 699
Comment pep:known_by_projection chromosome:gorGor3.1:9:78870413:78907474:-1 gene:ENSGGOG00000013745 transcript:ENSGGOT00000013792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTFQASVSFQDVTVEFTQEEWQHMGPVERTLYRDVMLENYSHLVSVGYCFTKPELIFTL
EQGEDPWLLEKEKGFLSRNSPEDSQPDEISEKSPENQGKHLWQVLFTNKLLTTEQEISGK
PHNRDITIFPARMMPCKCDIAGSACQGLSLMAPHCQYSKEKAHEHNVCDKWLISIKDGRT
NTQEKSFAYSKIVKTLHHKEEVIQHQTIQTLGQDFEYNESRKAFLEKAALVTSNSTHPKG
KSYNFNKFGENKYDKSTFIIPQNIHPEKSHYEFNDTGNCFCRITHKTLTGGKSFSQKSHI
RERHRVHIGVKPFEYGKSFNRNSTLPVHQRTHTTDKYSDYHPCTETFSYQSTFSVHQKVH
IRAKPCEYNECGKSCSMNSHLIWPQKSHTGEKPYECRECGKAFSEKSRLRKHQRTHTGEK
PYKCDGCDKAFSAKSGLRIHQRTHTGEKPFECHECGKSFNYKSILIVHQRTHTGEKPFEC
NECGKSFSHMSGLRNHRRTHTGERPYKCDECGKAFKLKSGLRKHHRTHTGEKPYKCNQCG
KAFGQKSQLRGHHRIHTGEKPYKCNHCGEAFSQKSNLRVHHRTHTGEKPYQCEECGKTFR
QKSNLRGHRRTHTGEKPYECNECGKAFSEKSVLRKHQRTHTGEKPYNCNQCGEAFSQKSN
LRVHQRTHTGEKPYKCDKCGKTFSQKSSLREHQKAHPGD
Download sequence
Identical sequences G3RD14
XP_004048362.1.27298 ENSGGOP00000013406 ENSGGOP00000013406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]