SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013492 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013492
Domain Number 1 Region: 56-162
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 325-427
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 434-550
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 4 Region: 202-303
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013492   Gene: ENSGGOG00000013825   Transcript: ENSGGOT00000013880
Sequence length 774
Comment pep:known_by_projection chromosome:gorGor3.1:8:23169453:23277753:-1 gene:ENSGGOG00000013825 transcript:ENSGGOT00000013880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPLCSHLCSCLAVLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
IQVEDIRIRAILSTYRKRTPVTEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
TYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSA
SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQL
GLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAG
VACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
Download sequence
Identical sequences A0A2J8N8Y9 G3RD94
ENSGGOP00000013492 ENSGGOP00000013492 XP_003823623.1.60992 XP_004046829.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]