SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013573 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013573
Domain Number 1 Region: 31-169
Classification Level Classification E-value
Superfamily Cupredoxins 1.89e-47
Family Ephrin ectodomain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013573   Gene: ENSGGOG00000013918   Transcript: ENSGGOT00000013964
Sequence length 237
Comment pep:novel chromosome:gorGor3.1:1:134062251:134085990:1 gene:ENSGGOG00000013918 transcript:ENSGGOT00000013964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSGAMRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPSLRREGYTVQVNVNDYLDI
YCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIK
FSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTL
PQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Download sequence
Identical sequences ENSGGOP00000013573 ENSGGOP00000013573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]