SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013586 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013586
Domain Number 1 Region: 146-215
Classification Level Classification E-value
Superfamily Homeodomain-like 2.35e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 54-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000314
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 22-53
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000235
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013586
Domain Number - Region: 113-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0399
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013586   Gene: ENSGGOG00000013931   Transcript: ENSGGOT00000013977
Sequence length 388
Comment pep:known_by_projection chromosome:gorGor3.1:1:159739700:159767223:1 gene:ENSGGOG00000013931 transcript:ENSGGOT00000013977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TALHRLRRDAHQHSGSLPLSYPDKIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQM
QLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNR
QLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKP
ARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEK
ESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDL
RDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIVAHAGQGVSQTLRAMAGGPTSD
ISTGSSVGYPDFPTSPGSWLDEMDHPPF
Download sequence
Identical sequences ENSGGOP00000013586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]