SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013679 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013679
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-68
Family BAR domain 0.00049
Further Details:      
 
Domain Number 2 Region: 265-297,328-385
Classification Level Classification E-value
Superfamily SH3-domain 2.77e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013679   Gene: ENSGGOG00000014022   Transcript: ENSGGOT00000014073
Sequence length 386
Comment pep:known_by_projection chromosome:gorGor3.1:1:89073872:89117528:1 gene:ENSGGOG00000014022 transcript:ENSGGOT00000014073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRNSQLNSARLEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNTI
GSSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVG
MDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences XP_004026132.1.27298 ENSGGOP00000013679 ENSGGOP00000013679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]