SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013818
Domain Number 1 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.38e-27
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 540-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 219-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000089
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013818   Gene: ENSGGOG00000014167   Transcript: ENSGGOT00000014213
Sequence length 601
Comment pep:known_by_projection chromosome:gorGor3.1:19:34399900:34734437:1 gene:ENSGGOG00000014167 transcript:ENSGGOT00000014213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQKLVMFRDVAIDFSQEEWECLDSAQRDLYRDVMLENYSNLVSLGLYTPKPQVISLLEQ
GKEPWMVGRELTRGLCSDWESWYEIEELSPKWFIDEDEISQEMVMERLASHGLECSSFRE
AWKYKGEFELHQGNAERHFMQVTAVKEISTGKRDNEFSNSGRSIPLKSVFLTQQKFPTIQ
QVHKFDIYDKLFPQNSVIIEYKRLRAEKESLIGNECEEFNQSTYFSKDIGIPPGEKPYES
HDFSKLLSFHSLFTQHQTTHFGKLPHGYDECGDAFSCYSFFTQPQRIHSGEKPYACNDCG
KAFSHDFFLSEHQRTHIGEKPYECKECNKAFRQSAHLAQHQRIHTGEKPFACNECGKAFS
RYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLNQHQRIHTGEKPYECNQCGKAFSRRIA
LTLHQRIHTGEKPFKCNECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFRTDSQLNRH
HRIHTEERPFECSKCGKAFSDALVLIHHKRSHAGEKPYECNKCGKAFSCGSYLNQHQRIH
TGEKPYECSECGKAFHQILSLRLHQRIHAGEKPYKCNECGNNFSCVSALRRHQRIHNRET
L
Download sequence
Identical sequences ENSGGOP00000013818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]