SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013910 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013910
Domain Number 1 Region: 431-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.71e-54
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-32
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 3 Region: 297-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000534
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013910   Gene: ENSGGOG00000014257   Transcript: ENSGGOT00000014310
Sequence length 737
Comment pep:known_by_projection chromosome:gorGor3.1:11:36009121:36103433:-1 gene:ENSGGOG00000014257 transcript:ENSGGOT00000014310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWGGTLDDFYVKGFYCAECRAGW
YGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHAKPGFVIQLRFVMLSLEFDYMCQYD
YVEVRDGDNRDGQIIKRVCGNERPAPIQSIGSSLHVLFHSDGSKNFDGFHAIYEEITACS
SSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEAGKSKIKASEDSLSVLEERNCSDP
GGPVNGYQKITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQPICI
KACREPKISDLVRRRVLPMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLPMGY
QHLHTQLQYECISPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKIENVTAPKTQGLRWP
WQAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVV
LGKFYRDDDRDEKTIQSLRISAIILHPNYDPILLDADIAILKLLDKARISTRVQPICLAA
SRDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIPVSV
TDNMFCASWDPTAPSDICTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHRLST
AFTKVLPFKDWIERNMK
Download sequence
Identical sequences ENSGGOP00000020809 ENSGGOP00000013910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]