SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013935 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013935
Domain Number 1 Region: 336-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 253-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 395-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-21
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 436-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 5 Region: 15-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 486-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000289
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 299-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000214
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013935   Gene: ENSGGOG00000014289   Transcript: ENSGGOT00000014336
Sequence length 616
Comment pep:known_by_projection chromosome:gorGor3.1:3:41524827:41536321:1 gene:ENSGGOG00000014289 transcript:ENSGGOT00000014336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQTVWFQGLSRNLLFQEPVTFEDVAVYFTQNEWASLHPTQRALYREVMLENYANVTSLY
PTAGGFPLDTERTEKVPGALSSFLPSSSSLELILALLPMSAFPFPKPDLIFQLEQGEAAW
GPDPWTLAGGEALRGMCTGGKTKTENEEKTAQLNISKESESHRLIVEGLLMDVPQHPDFK
DRLEKSQLHDTGNKTKIGDCTDLTVQDHESSTIEREEIARKLEESSVSTHLITKQGFAKE
QVFYKCSECGSYYNPHSDLHQHQRIHTNEKPYTCKECGKTFRYNSKLSRHQKIHTGEKPY
SCEECGQAFSQNSHLLQHQKLHGGQSPYECTDCGKTFSYNSKLIRHQRIHTGEKPFKCKE
CGKAFRCSYDCIIHERIHTGEKPYECKECGKSLSSNSVLIQHQRIHTGEKPYECKECGKT
FHHSSVFLQHQRFHTGEQLYKCNECWKTFSCSSRFVVHQRIHTGEKPYECQECGKTFSQK
ITLVQHQRVHTGEKPYECKECGKAFRWNASFIQHQKWHTRKKLINGTGLSAVKPYCPCAI
LSPLPPQHTCSAPAPPGPPLSSSHAVVLPPSVPFFLLLPSSEKANPSPVQIAHFFQDLAF
PGKSSLQSPNPLSRSL
Download sequence
Identical sequences ENSGGOP00000013935 ENSGGOP00000013935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]