SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014075 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014075
Domain Number 1 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 352-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.65e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 293-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 396-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000032
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000956
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014075   Gene: ENSGGOG00000003764   Transcript: ENSGGOT00000014481
Sequence length 499
Comment pep:novel chromosome:gorGor3.1:19:23168618:23195450:-1 gene:ENSGGOG00000003764 transcript:ENSGGOT00000014481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGK
EPWNMKRHELVKEPPVICSHFAQDLWPEQGREDSFQKVILRRYDKCGHENLQLKIGCTNV
DECKVHKKGYNKLNQSLTTTQSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVR
AFTPISXLTKHKVIHTGEKPYKCEQCGKAFNRSSILTKHKIIHTGEKPYKCEECGKAFNS
SSNLTEHKRVHTGEKPYKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFNRSSIL
TKHKIIHTGEKPYKCEECGKGFSSVSTLNTHKAIHAEEKPYKCEECGKASYSSSKLMEHK
RVHTGEKPYKCEECGKAFSWSSSLIEHKRSHTGEKPYKCEECGKTFSKVSTLTTHKAIHA
GEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKP
YKCEECGKSFSTFSVLTTQ
Download sequence
Identical sequences ENSGGOP00000014075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]