SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014157 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014157
Domain Number 1 Region: 118-273,370-409
Classification Level Classification E-value
Superfamily L domain-like 8.84e-24
Family Internalin LRR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014157   Gene: ENSGGOG00000014505   Transcript: ENSGGOT00000014565
Sequence length 800
Comment pep:known_by_projection chromosome:gorGor3.1:11:71857726:71961401:-1 gene:ENSGGOG00000014505 transcript:ENSGGOT00000014565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKGLVGAQAERRE
SLKVTSFEFKGKKGSRRENQVDLPGRILDQAFLLKHHCVRKPSDLCTINAKENDFKHFHS
VVYINASENLLPLEAFHTFPALKELDLAFNGIKTIYVKYGDFKLLEFLDLSFNSLTVEAI
CDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALETLMLDDNRL
SNPSCFASLAGLRRLKKLSLDENRIIRIPYLQQVQLYDESVDWNGGRGSPHKEPQFMLQS
KPRMLEDSDEQLDYTVLPMKKDVDRTEVVFSSYPGFSTSETTKICSLPPIFEILPVKSLK
ARNQTLAPPFPELRYLSLAYNKITKEDAVLPVALFPSLCEFVFHNNPLVAHTRAYFPIMA
PGVPPLLKSFLQERLGIHLIRRKIVKPKHHVLMSRKESRKVKSEIPKVPKQPLVLHHPCV
TTTKSPSKDMLEPEAELAEDLPTTKSTSVESEMPTESLEGHSPSRRTFVPLPPICSDSTV
HSEETLSHLSDTAVRLSPERPSDEDSKSTESIFLTQVSELPSSVVHKDDLELKEKDQKKP
PTAPREVKGTRRKLPTAFLPSKYHGYEELLTAKPDPAFIEPKGIQKNAQALQQMLKHPLL
CHSSKPKLDTLQKPYVHKEKRAQRIPIPPPKKTRAQLLDDIFIRLRDPRNITEAPLGAVL
HQWTERRLVNHKQYLEAKRLLKEFQARYRQLVSGSLRTVFGTTPLPTACPALSESQPKFG
HFLEFMDEFCQEPTANDSQG
Download sequence
Identical sequences ENSGGOP00000014157 ENSGGOP00000014157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]