SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014210 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014210
Domain Number 1 Region: 371-429
Classification Level Classification E-value
Superfamily RING/U-box 9.94e-17
Family RING finger domain, C3HC4 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014210   Gene: ENSGGOG00000011189   Transcript: ENSGGOT00000014620
Sequence length 436
Comment pep:known_by_projection chromosome:gorGor3.1:5:23896498:23908490:1 gene:ENSGGOG00000011189 transcript:ENSGGOT00000014620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFLLSLPTPPSASGHERRQRPEAKTSGSEKKYLRVMQANRSQLHSPPGTGSSEDASAP
QCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSH
SEARLPDDTAAESGDHGSSSFSEFRYLFKRLQKSLPYILILSVKLVMQHITGISLGIGLL
TTFMYANKSTVNQVFLRRERSSKIQCAWLLVFLAGSSVLLYYTFHSQSLYYSLIFLNPTL
DHLSFWEVFWIVGITDFILKFFFMGLKCLILLVPSFIMPFKSKGYWYMLLEELCQYYRTF
VPIPVWFRYLISYGEFGNVNRWSLGILLALLYLVLKSFIVYLHITSLKQVLRIFFTQPSY
GVAASKRQCSDVDDICSICQAEFQKPILLICQHIFCEECMTLWFNREKTCPLCRTVISDH
INKWKDGATSSHLQIY
Download sequence
Identical sequences ENSGGOP00000010910 ENSGGOP00000014210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]