SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014249 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014249
Domain Number 1 Region: 32-160
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-27
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 2 Region: 281-403
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000761
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014249   Gene: ENSGGOG00000014606   Transcript: ENSGGOT00000014659
Sequence length 437
Comment pep:known_by_projection chromosome:gorGor3.1:1:21383737:21397218:-1 gene:ENSGGOG00000014606 transcript:ENSGGOT00000014659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLPWSWKPGTLGAMQKAGAGGRRASDCGLAPHRPRCITKFAQYVGSFPVDDLDTQESVW
LVQQQLWALKDCPRRRAVILKFSLQGLKIYSGEGEVLLMAHALRRILYSTWCPADCQFAF
MARNPRSPASKLFCHLFVGSQPGEVQILHLLLCRSFQLAYLLQHPEKRAQPEPCPGPTGE
VPLKPLSSSGGLVREPFGRDQLSQNVHALVSFRRLPAEGLVGSGKELPESEGRARHARLG
NPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWPRGPGGHSCLVE
SEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPELGASGQWCLSVRTQCGVVPHQVF
RNHLGRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGRLNPTYEEQDCRPPGRPPRT
LRPLSHAKSEAELQGLG
Download sequence
Identical sequences ENSGGOP00000014249 ENSGGOP00000014249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]