SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014292 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014292
Domain Number 1 Region: 302-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 358-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.13e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 14-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-21
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 5 Region: 246-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.01e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 455-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.76e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 209-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000188
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014292   Gene: ENSGGOG00000014653   Transcript: ENSGGOT00000014703
Sequence length 545
Comment pep:novel chromosome:gorGor3.1:19:54962102:54974910:1 gene:ENSGGOG00000014653 transcript:ENSGGOT00000014703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLTESPLAMAEMDPTQGRVVFEDVAIYFSQEEWGHLDEAQRLLYRDVMLENLALLSSLG
SWHGAEDEEAPSQQGFSVGVSEVTTSKPCLSSQKVHLSETCGPPLKDILCLVEHNGIHPE
QDIYICEAELFKHPKQQIGENLSRGDDWIPSFGKNHRVHMAEEIFTCMEGWKDLPATSCL
LQHQGPQSEWKPYRDTEDREAFQTGQNDYKCSECGKTFTCSYSFVEHQKIHTGERSYECN
KCGKFFKYSANFMKHQTVHTSERTYECRECGKSFMYNYRLMRHKRVHTGERPYECNTCGK
FFRYSSTFVRHQRVHTGERPYECRECGKFFMDSSTLIKHQRVHTGERPYKCNDCGKFFRY
ISTLIRHQRIHTGERPYECSVCGELFRYNSSLVKHWRNHTGERPYKCSECGKSFRYHCRL
IRHQRVHTGERPYECSECGKFFRYNSNLIKHWRNHTGERPYECRECGKAFSHKHILVEHQ
KIHSGERPYECSECQKAFIRKSHLVHHQKIHSEERLVCSMNVGNSLAKTPTSLNIRDFTM
EKVYH
Download sequence
Identical sequences A0A2I2ZFQ3
ENSGGOP00000014292 XP_004061589.1.27298 ENSGGOP00000014292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]