SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014488 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014488
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 4 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 487-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-18
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 181-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000085
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014488   Gene: ENSGGOG00000014854   Transcript: ENSGGOT00000014901
Sequence length 566
Comment pep:known_by_projection chromosome:gorGor3.1:19:53958623:53969055:1 gene:ENSGGOG00000014854 transcript:ENSGGOT00000014901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLVTFGDVAVNFSQEEWEWLNPAQRNLYRKVMLENYRSLVSLGVSVSKPDVISLLEQGKE
PWMVKKEGTRGPCPGWEYVFKNSEFSSKQETYEESSKVVTVGARHLSYSLDYPSLREDCQ
SEDWYKNQLGSQEVHLSQLIITHKEILPEVQNKAYNKSWQTFHQDTIFDIQQSFPTKEKA
HKHEPQKKSYRKKSVEMKHRKVYVEKKLLKCNDCEKVFNQSSSLTLHQRIHTGEKPYACV
ECGKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKK
AFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNVCGKAFSH
RGYLIVHQRIHTGERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQIAYL
DQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQ
RIHTGEKPYECNVCGKAFSHRGYLIVHQRIHTGERPYECKDCRKSFRQRAHLAHHERIHT
MESFLTLSSPSPSTSNQLPRPVGFIS
Download sequence
Identical sequences ENSGGOP00000014488 ENSGGOP00000014488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]