SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014501 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014501
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.99e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.75e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 11-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 249-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 470-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 208-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000309
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014501
Domain Number - Region: 512-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0586
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number - Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0682
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014501   Gene: ENSGGOG00000014861   Transcript: ENSGGOT00000014914
Sequence length 568
Comment pep:novel chromosome:gorGor3.1:19:55320083:55327975:1 gene:ENSGGOG00000014861 transcript:ENSGGOT00000014914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAPRPPAQQGTVTFEDVAVNFSQEEWSLLSEAQRCLYHDVMLENLTLISSLGCWYGA
KDETPSKQTLSIQQESPLRTHWTGVCTKKVHLWGMCGPLLGGILHQGTQHNQKLNGFGAY
ENKLDDDANHHQDQKQHIGEKSYRSNAKGTSFVKNCKFHMSHEPFIFHEVGKDFLSSLRL
LQQEDIHTSGKSNFETKHGIPLQGGKTPYICGESTIPFSNKHSLVLHQRLLPREGPYVCS
DSGKFTSKSNSFNNHQGVHTGKRPYQCGQCDESFWYKAHLTEHQRVHTGERPYSCGECDK
SFSHKHSLVDHQRVHTGERPYECDECGKSFSHKRSLVHHQRVHTGERPYQCGECGKSFNH
KCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTGERPYECKECRKSFRYKSHL
TEHQRVHTGERPYECRECGKCFHQKGSLIQHQQIHSGERPHECGECGKCFHQKGSLIRHQ
QIHSGERPHECGECGKCFRQKGNLIKHQRVHTGERHHECKFGRSVGKKSTLIQHSDHTES
AYECGECAKSSSQKVGLIQQRSHWGKAF
Download sequence
Identical sequences ENSGGOP00000014501 ENSGGOP00000014501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]