SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014627 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014627
Domain Number 1 Region: 756-983
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 350-528
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.85e-55
Family Regulator of G-protein signaling, RGS 0.0000000177
Further Details:      
 
Domain Number 3 Region: 987-1121
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-43
Family Pleckstrin-homology domain (PH domain) 0.000000248
Further Details:      
 
Domain Number 4 Region: 35-121
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014627
Domain Number - Region: 151-160
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0654
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014627   Gene: ENSGGOG00000014973   Transcript: ENSGGOT00000015040
Sequence length 1546
Comment pep:known_by_projection chromosome:gorGor3.1:1:135943587:135997332:-1 gene:ENSGGOG00000014973 transcript:ENSGGOT00000015040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLACFPYSFSRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGSVDILPLY
GDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMA
RVTQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKDSRSLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRLRTKRTLGLGSLYGENDLLD
LDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEK
AQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPV
EVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGR
EEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRR
SIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEV
INELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKK
LREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQ
EAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILK
YVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISK
DKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVAT
DKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPMPVHPPPPG
PREPAHQGPTPSRVEMDDSDVFHGEPEPEELPGAETGTGSQQRVQGKHQVLLEDPEQEGS
AEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADSALEDVENLRHLILWS
LLPGHTMETQAAQEPEDDLTPTPSVISITSHPWDPGSPGQAPPGGEGDNTQLAGLEGERP
EQEDVGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGYKVVRKAEVAGSKVVP
ALPESGQSEPGPPEVEGGTKATGTGNCFYVSMPSGPLDSSTDHSGAPTSPPQPDSLPAGQ
TEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSL
GGESSATKEPLASDSRNSHELGPCPEDGSEAPLEDSTADAAASPGP
Download sequence
Identical sequences ENSGGOP00000014627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]