SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014628 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014628
Domain Number 1 Region: 10-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.74e-27
Family FHA domain 0.000000216
Further Details:      
 
Domain Number 2 Region: 391-448
Classification Level Classification E-value
Superfamily RING/U-box 8.32e-18
Family RING finger domain, C3HC4 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014628   Gene: ENSGGOG00000014987   Transcript: ENSGGOT00000015041
Sequence length 486
Comment pep:known_by_projection chromosome:gorGor3.1:6:38390822:38432133:1 gene:ENSGGOG00000014987 transcript:ENSGGOT00000015041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMIS
RNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEY
EYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVS
CESGQSVKSQGKGEVASTPSENLDPKLTALEPSKKTTGAPIYPGFPKVTEVHHEQKASNS
SASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQL
CAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEEDLKQQLAQALQEHWALMEELNRSKK
DFEAIIQAKNKELEQTKEEKEKVQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCA
HSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRER
KAKRLF
Download sequence
Identical sequences ENSGGOP00000014628 ENSGGOP00000014628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]