SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014681 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014681
Domain Number 1 Region: 337-423
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.41e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 194-276
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 113-190
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 432-511
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 5 Region: 2-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000484
Family Canonical RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014681   Gene: ENSGGOG00000015035   Transcript: ENSGGOT00000015095
Sequence length 520
Comment pep:novel chromosome:gorGor3.1:3:187053101:187106527:-1 gene:ENSGGOG00000015035 transcript:ENSGGOT00000015095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEK
LSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRIL
VPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMIL
EIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIY
NPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQANLIPGLNLSALGIFSTGLS
VLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
GAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEE
NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIV
RIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
Download sequence
Identical sequences ENSGGOP00000014681 ENSGGOP00000014681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]