SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014751 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014751
Domain Number 1 Region: 408-494
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.89e-22
Family Canonical RBD 0.0043
Further Details:      
 
Domain Number 2 Region: 30-68
Classification Level Classification E-value
Superfamily SAP domain 0.0000000641
Family SAP domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014751   Gene: ENSGGOG00000015109   Transcript: ENSGGOT00000015168
Sequence length 919
Comment pep:known_by_projection chromosome:gorGor3.1:19:5777721:5823254:1 gene:ENSGGOG00000015109 transcript:ENSGGOT00000015168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETLSGLGDSGAAGAAALSSASSETGTRRLSDLRVIDLRAELRKRNVDSSGNKSVLMER
LKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSL
ENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQE
HAIEDKETINNLDTSSSDFTILQEIEEPSLEPENEKILDILGETCKSEPVKEESSELEQP
FAQDTSSVGPDRKLAEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQ
PGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFD
ACNEVPPAPKESSTSEGADQKMSSPEDDSDTKRLSKEEKEIGRSSCGRNFWVSGLSSTTR
ATDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCINHLHKTELHGKMIS
VEKAKNEPVGKKTSDKRDSDGKKEKSSNSDRSTNFKRDDKCDRKDDAKKGDDGSGEKSKD
QDDQKPGPSERSRATKSGSRGTERTVVMDKSKGVPVISVKTSGSKERASKSQDRKSASRE
KRSIVSFDKVKEPRKSRDSESHSRVRERSEREQRMQAQWEREERERLEIARERLAFQRQR
LERERMERERLERERMHVEHERRREQERIHREREELRRQQELRYEQERRPAVRRPYDLDR
RDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDRGRYPDHSVDRREGSRSMMGEREGQ
HYPERHGGPERHGRDSRDGWGGYGSDKRMSEGRGLPPPPRGRRDWGDHGRREDDRSWQGT
ADGGMMDRDHKRWQGGERSMSGHSGPGHMMNRGGMSGRGSFAPGGASRGHPIPHGGMQGG
FGGQSRGSRPSDARFTRRY
Download sequence
Identical sequences ENSGGOP00000014751 ENSGGOP00000014751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]