SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014752 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014752
Domain Number 1 Region: 676-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 620-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 732-789
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 397-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 116-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.35e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 11 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 13 Region: 774-826
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 14 Region: 508-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 15 Region: 84-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014752   Gene: ENSGGOG00000015116   Transcript: ENSGGOT00000015169
Sequence length 865
Comment pep:known_by_projection chromosome:gorGor3.1:19:23542006:23557666:-1 gene:ENSGGOG00000015116 transcript:ENSGGOT00000015169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFSPEKNTQGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPD
LITCLEQGKEPWNMKQHEMVDEPTCGKGFNRSSNLTIHKFVHTGEKPYKCEECGKAFNWS
SSLTKHKRFHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLT
KHKIIHTGEKPYKFEECGKAFRQSLTLNKHKIIHSREKPYKCKECGKAFKQFSTLTTHKI
IHAGKKLYKCEECGKAFNQSSSLSTHKIIHTGEKSYKCEECGKAFLWSSTLRRHKRIHTG
EKPYKCEECGKAFSHSSALAKHKRIHTGEKPYKCQECGKAFSNSSTLANHKITHTEEKPY
KCKECDKAFKRLSTLTKHKIIHAGEKLYKCEECGKGFNRSSNLTIHKFIHTGEKPYKCEE
CGKAFNWSSSLTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECGKA
FSRSSTLTKHKTIHTGEKPYKCKECGKAFKHSSALAKHKIIHAGEKLYKCEECGKAFNQS
SNLTTHKIIHTKEKPSKSEECDKAFIWSSTLTEHKRIHTREKTYKCEECGKAFSQPSHLT
THKRMHTGEKPYKCQECGKAFSQSSTLATHKIIHTGEKPYKCEECGKAFRKSSTLTEHKI
IHTGEKPYKCEECGKAFSQSSTLTRHMRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTG
EKPYKCEECGKAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPY
KCGECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIHTITPVIPALW
EAEAGGSRGQEIETILANTVKPRLY
Download sequence
Identical sequences ENSGGOP00000014752 ENSGGOP00000014752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]