SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014927 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014927
Domain Number 1 Region: 33-192
Classification Level Classification E-value
Superfamily Ganglioside M2 (gm2) activator 1.57e-66
Family Ganglioside M2 (gm2) activator 0.0000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014927   Gene: ENSGGOG00000015302   Transcript: ENSGGOT00000015354
Sequence length 193
Comment pep:known_by_projection chromosome:gorGor3.1:5:135163356:135180698:1 gene:ENSGGOG00000015302 transcript:ENSGGOT00000015354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSLMQSPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIV
PGNVTLSVVGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIP
TGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSGGKR
LGCIKIAASLKGI
Download sequence
Identical sequences G3RH12
ENSGGOP00000014927 ENSGGOP00000014927 XP_004042891.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]