SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015001 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015001
Domain Number 1 Region: 32-137
Classification Level Classification E-value
Superfamily E set domains 0.00000000182
Family ML domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015001   Gene: ENSGGOG00000015375   Transcript: ENSGGOT00000015429
Sequence length 142
Comment pep:known_by_projection chromosome:gorGor3.1:8:72396877:72435198:1 gene:ENSGGOG00000015375 transcript:ENSGGOT00000015429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFLFFSTLFSSTFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGL
LHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGGKYKCVVEAI
SGSPEEMLFCLEFVILHQPNSN
Download sequence
Identical sequences ENSGGOP00000015001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]